PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G049600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 289aa    MW: 31767.5 Da    PI: 9.1155
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G049600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.54e-10550244
                       SSS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHH CS
    Myb_DNA-binding  2 grWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrw 44
                       g WT eEd+ + +a++++ ++     W++Ia+ ++  +t  ++k ++
  Aqcoe3G049600.1.p  5 GEWTREEDKAFENAIAMHWTEdnkdKWEKIASSVP-SKTVAEVKRHY 50
                       79*********************************.**********9 PP

2Myb_DNA-binding43.38.4e-14124168347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE+ l++ +  ++G+g+W++I+r   ++Rt+ q+ s+ qky
  Aqcoe3G049600.1.p 124 PWTEEEHRLFLLGLDKFGKGDWRSISRNYVQTRTPTQVASHAQKY 168
                        7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.961158IPR017884SANT domain
SMARTSM007171.2E-8356IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-7455IPR009057Homeodomain-like
PfamPF002492.9E-8550IPR001005SANT/Myb domain
SuperFamilySSF466891.1E-10660IPR009057Homeodomain-like
CDDcd001674.50E-9650No hitNo description
PROSITE profilePS5129418.03117173IPR017930Myb domain
SuperFamilySSF466891.45E-17119174IPR009057Homeodomain-like
SMARTSM007171.7E-10121171IPR001005SANT/Myb domain
TIGRFAMsTIGR015578.7E-17121171IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.2E-11122167IPR009057Homeodomain-like
PfamPF002491.7E-11124168IPR001005SANT/Myb domain
CDDcd001674.40E-10124169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MSNEGEWTRE EDKAFENAIA MHWTEDNKDK WEKIASSVPS KTVAEVKRHY DILLEDLKAI  60
EAGHVPLPNY VGDETRTKEN HDLKEDSKLN YSYGTGFYGV GGGSVRQGGK GGSRSEQERR  120
KGIPWTEEEH RLFLLGLDKF GKGDWRSISR NYVQTRTPTQ VASHAQKYFI RLSSMNRDRR  180
RSSIHDITSI NGGDVSSPQG PITGQQTNTT TSTATVVGQS VKHRSLPHNM PGVGMYGAPM  240
GQPISGPGGH MVSAVGTPVM LPPGHHHPAH PPYVVPVAYP VVPPTMHQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-157701173RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00191DAPTransfer from AT1G49010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014507110.11e-135PREDICTED: transcription factor DIVARICATA
TrEMBLF6GTI51e-133F6GTI5_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g04130.t011e-133(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.19e-71MYB family protein